PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100243370261
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 346aa    MW: 38762.2 Da    PI: 6.996
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100243370261genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.61.2e-32182236155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   k+r+rWt++LH+rFve+v++LGG++kAtPk+il+lm+ +gLt+ hvkSHLQkYR 
  Ote100243370261|100243370261 182 KARIRWTQDLHDRFVECVNRLGGPDKATPKQILKLMNTEGLTIFHVKSHLQKYRN 236
                                   68****************************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.625179239IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-29179237IPR009057Homeodomain-like
SuperFamilySSF466893.94E-17180236IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-25182237IPR006447Myb domain, plants
PfamPF002497.1E-9186235IPR001005SANT/Myb domain
PfamPF143791.6E-10269309IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 346 aa     Download sequence    Send to blast
MKGIQHNYGS YTSEFAPDFP NFFQQSFPPQ QQHASNQSAP SNSFQQANSS GTIIGRIGSP  60
ASAFCATEIA MGLSHYDFPE SCSQQSKNLY SSLHQPGNGL FGESTARNQF SNLSEREKIL  120
HLKHKLLGDL DDSDRGSPFA SFDANHDHEV SHNLYAPHLV PMKQFGRPIN SSTSPGAVSS  180
HKARIRWTQD LHDRFVECVN RLGGPDKATP KQILKLMNTE GLTIFHVKSH LQKYRNAKHI  240
PESVEAAGKA ENKTDMDRAT QFDIKTGVHL KEALQLQLDV QRRLHEQLEM RIEEQSQRLK  300
MMFDQQQKTN NNKCANANSL STAVEDPEVL VLDASDDDMI FPSKIS
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011075159.11e-127PREDICTED: protein PHR1-LIKE 1
TrEMBLA0A022RJM11e-103A0A022RJM1_ERYGU; Uncharacterized protein
STRINGSolyc10g078720.1.18e-77(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458